GenomeNet

>bsu:BSU27190 no KO assigned | (RefSeq) yrzI; hypothetical protein (A)
MTINLFFLTLTIKKRFKSLEEFEREQQIEQIYDEMKESQLKHLYLTNWR

BLAST