GenomeNet

>bsu:BSU27230 no KO assigned | (RefSeq) yrhD; hypothetical protein (A)
MATPITTIKKETKTAEQIKLEKIEELKELLAENEDAVSKTMTLMNELNDLGIFDAATSML
RAKEDIAKIALGQVSREPVTNLINTMMAAGGALTKADPEFTAKLLESVMAGTEQAQSFLK
EDKKVGILDLLKAMNDPDINRAVGFGLQFLKGMGKELREQ

BLAST