GenomeNet

>bsu:BSU27300 no KO assigned | (RefSeq) yrrS; hypothetical protein (A)
MSNNQSRYENRDKRRKANLVLNILIAIVSILIVVVAANLFINSPSSKDVSKDSETAQKQE
SPASGKTEKKSDEDIKDSKKDTSDSEKDSEKSSDSDSKKDDSSSKKDDSDSDSSSDSAGD
GLKDAKVTEGGSSSDVEKTYENPDWKAVGTEQTGEHAATYDSSSQDWAEMLKAISYATGV
STDNMTVLWLGNNGSPQDAKGKILDKATGNKYQVTITWVDEKGWKPTKVEKLK

BLAST