GenomeNet

>bsu:BSU27370 K07082 UPF0755 protein | (RefSeq) yrrL; hypothetical protein (A)
MYINQQKKSFFNKKRIILSSIVVLFLIIGGAFLYGKSLLEPVEKDSKTTVNINIPSGSSV
SAIASILKKNDVIKSEKAFQYYVKYKGASGFQAGFYHLNKGMDLDAIIQKLTSGATGYAF
QITVTEGAQLTQIAAAIADETKYSKKQVIAKLDDETFINQLKKEFPDTVTNDVFNKNIKH
PLEGYLFPATYPFNDPDTSLEDIIKAMIKQTNSYVETYKSEMKKNKVSVHKLLTMASLIE
EEATEKADRHKIASVFYNRLKKKMPLQTDPTVLYAAGKHKDRVLYKDLEIDSPYNTYKNT
GLTPGPIANAGMSSWEAALHPDKTDYLYFLAKSNGEVVFTKTLKEHNKAKEKYISSKNEK

BLAST