GenomeNet

>bsu:BSU27440 K10039 aspartate/glutamate/glutamine transport system substrate-binding protein | (RefSeq) glnH; ABC transporter substrate-binding protein GlnH (A)
MKKIFSLALISLFAVILLAACGSKGSNGEASKESKKDTLAAIKDNDKIVFGVKTDTRLFG
LKNPSSGEIEGFDIDIAKQIAKDILGDEKKAQFKEVTSKTRIPMLQNGDIDAIVATMTIT
EERKKEVDFSDVYFEAGQSLLVKKGSKIKSVENLGKGSKVLAVKGSTSSQNIREKAPEAS
VLEFENYAEAFTALKSGQGDALTTDNAILYGMADENKNYQLTGKPFTDEPYGIAVKKGQS
ALAKEINASLKKMKSDGRYDEIYKKWIKEDPAE

BLAST