GenomeNet

>bsu:BSU27450 K10040 aspartate/glutamate/glutamine transport system permease protein | (RefSeq) glnM; glutamine ABC transporter permease protein GlnM (A)
MNVSILFDNFSMYMDGFYHTLLASVIALAGSFVLGVAVAVMRITVFKPLQWLGTAYVEFI
RNIPLLLITFVFYFGLPNAGLRLDGFQAGTVALTIYTSAFIAEAIRAGIQSVSKGQMEAA
RSSGFTYSQAMLHIILPQAIKIVIPPLGNQFLNLVKNSSILGVVAGLDLMYQADLVSSST
LVVFDVYIFVALFYLVLTIPLSIGVNYLEKRLEKSY

BLAST