GenomeNet

>bsu:BSU27460 K10040 aspartate/glutamate/glutamine transport system permease protein | (RefSeq) glnP; glutamine ABC transporter permease protein GlnP (A)
MDFIGAYSQEHLAFLWDGFLVTLYVAFISIILSFFFGLIAGTLRYAKVPVLSQLIAVLVE
TIRNLPLLLIIFFTFFALPEIGIKLEITAAAITALTIFESAMLSEIIRSGLKSIDKGQIE
AARSSGLSYTQTLFFIVMPQALRRMVPPIVSQFISLLKDTSLAVVIALPELIHNAQIING
QSADGSYFFPIFLLAALMYFAVNYSLSLAARRLEVRQT

BLAST