GenomeNet

>bsu:BSU27490 no KO assigned | (RefSeq) yrrB; TPR repeat-containing protein YrrB (A)
MQEGDYEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATA
YYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVE
LNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKAL
EMLDKAIDIQPDHMLALHAKKLIDPS

BLAST