GenomeNet

>bsu:BSU27640 no KO assigned | (RefSeq) yrvC; hypothetical protein (A)
MRVRESELPGIGQKVEMITRNRDKISIIIHHDGRRELYYFDENDHEECVASVQFDDAEAR
QMSAILGGMAYKPKALEQVESALDDLIIEWCKAEAGAPAIHQTIGDLNVGQEYHVTVIAI
VKKNQDKQLNPSSETVIDEGDTLVISGEGTGLKRLIREKLTAKGA

BLAST