GenomeNet

>bsu:BSU27690 no KO assigned | (RefSeq) yrzE; hypothetical protein (A)
MSDGFEQKEQKPFNTGREETIMEETKQVGKGILYGLIAIFSAMLLTSLAVSLLLTATSLE
ESSFNWLITAISFLSLFIGGFISGGKGKERGWMIGALTALSFSLIILLFQYLGFGKTFTA
EQLIFHLGFLGVCMLGGIFGVNMRGNRSST

BLAST