GenomeNet

>bsu:BSU27970 K06402 stage IV sporulation protein FB [EC:3.4.24.-] | (RefSeq) spoIVFB; stage IV sporulation protein FB (A)
MNKWLDLILKIHVHPFLWIIAALGLLTGHMKALLCLLLIVLIHELGHAALAVFFSWRIKR
VFLLPFGGTVEVEEHGNRPLKEEFAVIIAGPLQHIWLQFAAWMLAEVSVIHQHTFELFTF
YNLSILFVNLLPIWPLDGGKLLFLLFSKQLPFQKAHRLNLKTSLCFCLLLGCWVLFVIPL
QISAWVLFVFLAVSLFEEYRQRHYIHVRFLLERYYGKNRELEKLLPLTVKAEDKVYHVMA
EFKRGCKHPIIIEKSGQKLSQLDENEVLHAYFADKRTNSSMEELLLPY

BLAST