GenomeNet

>bsu:BSU27980 K06401 stage IV sporulation protein FA | (RefSeq) spoIVFA; stage IV sporulation protein FA (A)
MSHRADEIRKRLEKRRKQLSGSKRFSTQTVSEKQKPPSWVMVTDQEKHGTLPVYEDNMPT
FNGKHPLVKTDSIILKCLLSACLVLVSAIAYKTNIGPVSQIKPAVAKTFETEFQFASASH
WFETKFGNPLAFLAPEHKNKEQQIEVGKDLIAPASGKVQQDFQDNGEGIKVETSSDKIDS
VKEGYVVEVSKDSQTGLTVKVQHADNTYSIYGELKDVDVALYDFVDKGKKLGSIKLDDHN
KGVYYFAMKDGDKFIDPIQVISFE

BLAST