GenomeNet

>bsu:BSU28050 K06287 septum formation protein | (RefSeq) maf; septum formation protein Maf (A)
MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADL
HPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYD
KTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMR
ALRHFDIRA

BLAST