GenomeNet

>bsu:BSU28070 K02236 leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-] | (RefSeq) comC; type 4 prepilin-like proteins leader peptide-processing enzyme (A)
MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGK
CKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIP
NRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIG
FVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIIS
FYIKMALG

BLAST