GenomeNet

>bsu:BSU28180 no KO assigned | (RefSeq) ysxD; hypothetical protein (A)
MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF
IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL
YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR

BLAST