GenomeNet

>bsu:BSU28410 K01994 LuxR family transcriptional regulator, transcriptional regulator of spore coat protein | (RefSeq) gerE; spore germination protein GerE (A)
MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRS
QAVVELLRMGELEL

BLAST