GenomeNet

>bsu:BSU28450 K00241 succinate dehydrogenase / fumarate reductase, cytochrome b subunit | (RefSeq) sdhC; succinate dehydrogenase cytochrome b558 subunit (A)
MSGNREFYFRRLHSLLGVIPVGIFLIQHLVVNQFAARGAEAFNSAAHFMDSLPFRYALEI
FIIFLPLIYHAVYGVYIAFTAKNNAGQYSYMRNWLFVLQRVTGIITLIFVSWHVWETRIA
AQMGAEVNFDMMANILSSPAMLGFYIVGVLSTIFHFSNGLWSFAVTWGITVTPRSQRIST
YVTLIIFVALSYVGLKAIFAFV

BLAST