GenomeNet

>bsu:BSU28520 K03522 electron transfer flavoprotein alpha subunit | (RefSeq) etfA; electron transfer flavoprotein subunit alpha (A)
MGKKVIVLGEIRDGELRNVTFEAIAAGRTISGDGEVIGVLIGENVQSIAQELIHYGADKV
LTAEDPKLKTYTADGYSQVMRGVIEQENPDSVIFGHTAMGKDLSPKLAARLQTGLISDAI
DVSVTGGNVVFTRPIYSGKAFERVISTDPMIFATIRPNNIQASEKDTSRSGSIESIDVSL
TDLRTVIQEVVKKTADGVDLSEAKIIVAGGRGVKSKEGFQPLQELAEVLGAAVGASRGAC
DADYCDYALQIGQTGKVVTPDLYIACGISGAIQHLAGMSNSKVIVAINKDPEADIFKIAD
YGIVGDLFEVVPLLTEEFKQLNIHS

BLAST