GenomeNet

>bsu:BSU28570 K08989 putative membrane protein | (RefSeq) yshE; hypothetical protein (A)
MSDFWENELVEIAAYYSVAVLCLVLFLTVFELVTAYKNWEEIQKGNLAVAMATGGKILGI
ANVFQHSISQHNSLLQMIGWGVYGFVMLLISYFIFEFLTPRFKIDQEIENDNRAVGFISF
VISVGLSFVVAAGI

BLAST