GenomeNet

>bsu:BSU28680 K00104 glycolate oxidase [EC:1.1.3.15] | (RefSeq) glcD; glycolate oxidase subunit GlcD (A)
MITKDVKEQLIQVSGPENFDDSNAGRLVYSYDATPQYQSMPDAVIAPRNTDEISRILTIC
SEHRVPIVPRGSGTNLCGGTCPTEGGLVLLFKHMNQILEIDEENLTATVQPGVITLDMIR
AVESKGLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDYVIGLEVVLANGDIIRTG
GKLAKDVAGYDLTRLFVGSEGTLGIVTEAIVKLVPKPETKKTLLALYENIDAAAQTVSDI
IAAKIIPATLEFLDQPTLLVIEDYAKIGLPTSAKAVLLIEQDGPFETVERDMEKIEAICK
KGDAVSVQTAQTEEEAFALTEARRSALSALARLKPTTILEDATVPRSEIANMVKAINDIA
AKYDISICTFGHAGDGNLHPTCTTDIRNKDEMERVEQAFAEIFEKAIELGGTITGEHGVG
EMKAPYLEMKLKKEGIDAMKALKAAFDPRNILNPGKMFAKDARKRVVAER

BLAST