GenomeNet

>bsu:BSU28690 K11473 glycolate oxidase iron-sulfur subunit | (RefSeq) glcF; glycolate oxidase iron-sulfur subunit (A)
MTTEKEMKQIQNEFKERMDEGELLNCMRCGFCLPSCPTYIESGFQETHSPRGRIALMKAV
ADGMIEPDEDVERSLSLCLGCRACEPVCPSGVKYGQLLEEARDIIHQNKKHSLGERVMRK
TAFHELFPHQNRMRSAVSLIGLYQRSGLQTAVRKSGMLRVLPEHLRTMEAVLPDVPKSKD
MKHRPRFLPSIGPMKKRVAFFSGCLMDTMFLPTNNATLKLLQLAGCDIVIPPEQACCGAL
HGHSGEKNTGKELAKQNIAAFEALDVDAVITNAGGCGAFLTEYDHLLKDDPEWSERAAAF
VQKLKDFSSVLVELDFHQMDLALETPQVVTYQDSCHLRNVMHTSLEPRQLLKSIKGAEFK
EMEKADSCCGSAGIYNIVEVEMSMKILDSKMAAVKATEAILIVTANPGCLLQMKLGIERE
GLSGKVRAVHLADLLLEAAGHKTS

BLAST