GenomeNet

>bsu:BSU28910 K05338 holin-like protein | (RefSeq) ysbA; antiholin-like protein LrgA (A)
MSAKKVYGFLTQAFIFAVIMLVSNMIAAIVPIPIPASVVGLVLLFLLLCLKVIKLEQVET
LGTSLTSLIGFLFVPSGISVMNSLGVMQQYGLQIVLVILLATIILLGATGLFSQLILSLS
GKRKTEADMKTKTVQSPQNNNELVHH

BLAST