GenomeNet

>bsu:BSU28970 no KO assigned | (RefSeq) ytxB; tvp38/tmem64 family membrane protein YtxB (A)
MKRKTAVKWLAVLAGAGLLYWGNKTYLNVSPKEIRVWVLSFGVFAPLMFIGISIVRPLVL
FPVSVISIAGGLAFGPLLGTLYTLFGSMCASAVSFFAAGLFSAKKNGHYERLEAIQKQME
DNGFFYIFLLRILPINFDFVSYAAGLSNVKALPYFAATAVGIIPGTIALNVLGASFLAGN
LPAFFMVLALYIVFISLPFIFRKKMQNLFQESN

BLAST