GenomeNet

>bsu:BSU29260 no KO assigned | (RefSeq) ytpI; hypothetical protein (A)
MLVLVFLIGLSACFYVYYKVKGVRAKPSLAKEICSAKSSMALGSLVLFYGLNQMILFHSV
LTLVIGGIFIVIGAGSAWAGYKAFRHYNPLHAKEAERDHA

BLAST