GenomeNet

>bsu:BSU29360 K16958 L-cystine transport system permease protein | (RefSeq) tcyL; L-cystine transport system permease protein TcyL (A)
MEKAFDMNMIGDFVPTLTAYLPVTLYILTLSLLFGFVLGLFLALPRIYNIPIVNQLAKVY
ISFFRGTPIMVQLFIVFYGIPALTGLIGIDTSKMDPFYAAVATYALSNAAAAAEIIRAGV
GSVDKGQTEAAYSIGLSGSQAFRRIVLPQALVQAFPNMGNMVISSLKDTSLAFSIGVMDM
SGRGQTLITSSNHSLEVYIALSIVYYAVAVLFEWFFRVAEKRIKKNQTRIVTVFDMNIH

BLAST