GenomeNet

>bsu:BSU29760 no KO assigned | (RefSeq) ytxJ; hypothetical protein (A)
MAKQLIQSEEEFKRIAEQEGVFVFLKHSTTCPISQAAFHEFDAFANQHEDVPAYYLQVQE
ARPLSNFIAETYGVKHESPQIFIIQNGEVKWHTSHSQITEAAIEQHLS

BLAST