GenomeNet

>bsu:BSU29870 no KO assigned | (RefSeq) ytzB; hypothetical protein (A)
MKLRHLLLGAGLGICTAVVVRQYVMKPYISSEKALRIVKSAFKQRGPIDGSWIYTQPEPY
NINGETVQVYKTGITRSAFGELEQYEVMVDAKTGEIVDVIDTIAS

BLAST