GenomeNet

>bsu:BSU30090 no KO assigned | (RefSeq) yteU; hypothetical protein (A)
MEHDGSLGRMLRFCEWIMRFAYTNLLWLFFTLLGLGVFGIMPATAALFAVMRKWIQGQDN
VPVLKTFWQEYKGEFFRSNLLGAVLALIGVIIYIDLALIYPSHFLLHILRFAIMIFGFLF
VSMLFYVFPLLVHFDWKKRLYVKFSLLLSVAYLQYTLTMLALTVALFFLLAYLPGIVPFF
SVSLISYCHMRIVYAVLLKVEQHGGEPQRKSHIRKAFYPETR

BLAST