GenomeNet

>bsu:BSU30160 K17318 putative aldouronate transport system substrate-binding protein | (RefSeq) ytcQ; peptide ABC transporter substrate-binding protein (A)
MGNKWRVLLIVLVLALGGVLAGCKGTDQSSAEGKAGPDSKVKLSWMAILYHQQPPKDRAI
KEIEKLTNTELDITWVPDAVKEDRLNAALAAGNLPQIVTIQDIKNSSVMNAFRSGMFWEI
GDYIKDYPNLNKMNKLINKNVTIDGKLYGIYRERPLSRQGIVIRKDWLDNLNLKTPKTLD
ELYEVAKAFTEDDPDKDGKDDTFGLADRNDLIYGAFKTIGSYEGMPTDWKESGGKFTPDF
MTQEYKDTMNYMKKLRDNGYMNKDFPVTSKTQQQELFSQGKAGIYIGNMVDAVNLRDHAS
DKSMKLEIINRIKGPDGKERVWASGGHNGVFAFPKTSVKTEAELKRILAFFDRIAEEDVY
SLMTYGIDGVHYNKGEDKTFTRKESQVKDWQTDIQPLSALIAIDKAYLKNTGDPLRTAYE
ELTEDNEKIIVSNPAESLYSASESERGDELKKIIDDATYKYMIGDITESQFDKEVEKWES
SGGKQIIQEYEEAFKQAK

BLAST