GenomeNet

>bsu:BSU30440 K16919 acetoin utilization transport system permease protein | (RefSeq) ytrC; ABC transporter permease (A)
MVDRGLLYREWKQNQVVILLSIAFLVLANPLSIVNTYLSYQGCLDRQDPQYCDFIVNYSI
SNLIDINWVPGVILAVCFLGMERSKGTMDFILSLPYNRSQIFQTKFWLGGFVIVLSQLIG
FLLAWLLILVYNPEHVYFFEHSSIGVIVISFMAFSLVMAAGALTGNAFAQLLTAFSAAIL
PYLIIALPVGNLEVVFGANIWEIFPSPESYFSLASNLSNLVPISYVVNEWLINSKYLLLI
PAVMSMLFYLIGFISFKKLPSERNGHFFLWNRLDRPVQILVMAFGILGFGLFGYYTGHSI
IGYILGMIIGAVAGFFVSYFSIYKKTKV

BLAST