GenomeNet

>bsu:BSU30610 K02049 NitT/TauT family transport system ATP-binding protein | (RefSeq) ytlC; ABC transporter ATP-binding protein (A)
MSFLHVDHVTHTYFSIKEKTTAVRDIHFDAEKGDFISFLGPSGCGKTTLLSIIAGLIEPS
EGRVLIEGREPNQKEHNIGYMLQQDYLFPWKSIEENVLLGLKIADTLTEESKAAALGLLP
EFGLIDVEKKYPKELSGGMRQRAALARTLAPNPSLLLLDEPFSALDFQTKLSLENLVFRT
LKEYQKTAVLVTHDIGEAIAMSDTIFLFSNQPGTIHQIFTIPKELAAMLPFDARQEPSFQ
TLFQTIWKELNSLEKQQRNH

BLAST