GenomeNet

>bsu:BSU30680 K08998 uncharacterized protein | (RefSeq) ytjA; membrane protein insertion efficiency factor (A)
MKTLFIALIRGYQKFISPLTPPTCRFYPTCSQYGIEAIKTHGALKGGWLTIKRILKCHPF
HPGGVDPVPEKKQKH

BLAST