GenomeNet

>bsu:BSU31260 K03406 methyl-accepting chemotaxis protein | (RefSeq) mcpB; methyl-accepting chemotaxis protein McpB (A)
MKTFINWLKKPSISKKLIVSFIAILIIPILILEFSSYRSASGKLDQEIMGNAKNSVDTFN
TTVTNDLGEKAKAVTFFSESLKRSAFKGKSNQEEIKAKFSQYVSINQGVARIYGGADNGT
YVQAPKEKLPEGYDPRQRPWYQDAMKAGGEIVVTDPYVAASDGSMVITIAQELKDGSGVV
AMDITIDKLLEQMKQIKVGKEGYAFIATKNKTYVAHKNHKAGEKLSGDWVAKMYANDSGE
LQYTLNNEDKKMTYTTNELTGWKIAGTMYMDEIKDASKSVLTTGMIVLIASIVAGGILIL
FIVRSITKPLKRLVQSSKTISRGDLTETIEIHSKDELGELGESFNEMGQSLRSLISAIQD
SVNNVAASSEQLTASAGQTSKATEHITMAIEQFSNGNEEQSEKVESSSHQLNLMNEGLQQ
VSQTSSDITKASIQSTEIAGTGEKFVQQTVGQMNSINQSVQQAEAVVKGLEGKSKDITSI
LRVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSADSAKEIEKLIQEI
VAEIDTSLHMFKEVNQEVQSGLVVTDNTKESFQSIFSMTNEIAGKLQTMNSTVEQLSDRS
QHVSAAVSGIADVSKESSASIQDIAASAEEQLASMEEISSSATTLAQMAEELRDLTKQFK
IE

BLAST