GenomeNet

>bsu:BSU31490 K18770 penicillin-binding protein 4 [EC:2.4.1.129 3.4.16.4] | (RefSeq) pbpD; penicillin-binding protein 4 (A)
MTMLRKIIGWILLLCIIPLFAFTVIASGKEVKQMKSLDQVLDKNIDLKDISLVQNSYMYD
RDGSLVSEIVSDHENRVLVPFNKIPEEVKQIFLTSEDRHFYEHKGFDFMGMVRATASNVK
DKKIDQGASTITQQLSRNLYLSHERSFSRKLTELAYSYQLEKKYTKNEILEAYLNTIYFN
NGVYGVGSAAQFYFSKPLKSLTVGEMAFICAIPNNPTLYDPLKHFDYTKSRQERLLKGLK
DAGVITDKELKKAVKQKIKLDVEKREDKYPDYVSYVNDEFTQLVSESEGFDKRLQKASGK
QKEKIENELSARVSTLMKDGVKIYTALDPYMQNQVVAQMNSKLPYADVQGGAAVINHQTH
QIIALSGGKNYQKYDFNRAYQAYRQPGSSIKPLLDYGPYIEQTGATTSSTIDASKFCSKD
YCPQNYNNRTYGTVTLDTAFKNSYNTPAIRMLDRVGIQKAFSYIEPYHFAKLVDSDYLLP
AALGGFTNGMTPLEMTKAYTTFGNSGSYTPSHAITKVTDLKGKTLYKWNDKATQIFSVRT
NMQLKKLMSSVVKSGTGKKAYFNAPYIGGKTGTSNDYHDMWFVGLTDTYTMGVWVGKDTP
TSVEYLHSISPQLSIWKGTLQAAY

BLAST