GenomeNet

>bsu:BSU31500 no KO assigned | (RefSeq) yuxK; hypothetical protein (A)
MTSEQIPNRVLLFDGVCNLCNGAVQFIIKRDPDGLISFTSLQSETGQSLLKKSGLPTDRF
DSFVFIEDGQVYTKSTAAIKVFRHLRGPWRLFVLFFAVPKPVRDMVYSFIAKNRYKWFGK
KNECMLPSPSIKKRFLP

BLAST