GenomeNet

>bsu:BSU31540 K07335 basic membrane protein A and related proteins | (RefSeq) yufN; lipoprotein (A)
MNKRKIGLAMSLVIAAGTILGACGNSEKSSGSGEGKNKFSVAMVTDVGGVDDKSFNQSAW
EGIQAFGKENGLKKGKNGYDYLQSKSDADYTTNLNKLARENFDLIYGVGYLMEDSISEIA
DQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSKSGKIGFVGGMESELIKK
FEVGFRAGVQAVNPKAVVEVKYAGGFDKADVGKATAESMYKSGVDVIYHSAGATGTGVFT
EAKNLKKEDPKRDVWVIGVDKDQYAEGQVEGTDDNVTLTSMVKKVDTVVEDVTKKASDGK
FPGGETLTYGLDQDGVGISPSKQNLSDDVIKAVDKWKKKIIDGLEIPATEKELKTFKAE

BLAST