GenomeNet

>bsu:BSU31550 K23537 general nucleoside transport system ATP-binding protein | (RefSeq) yufO; ABC transporter ATP-binding protein (A)
MEYVIEMLNIRKAFPGIVANDNINLQVKKGEIHALLGENGAGKSTLMNVLFGLYQPERGE
IRVRGEKVHINSPNKANDLGIGMVHQHFMLVDTFTVAENIILGKEPKKFGRIDRKRAGQE
VQDISDRYGLQIHPEAKAADISVGMQQRAEILKTLYRGADILIFDEPTAVLTPHEIKELM
QIMKNLVKEGKSIILITHKLKEIMEICDRVTVIRKGKGIKTLDVRDTNQDELASLMVGRE
VSFKTEKRAAQPGAEVLAIDGITVKDTRGIETVRDLSLSVKAGEIVGIAGVDGNGQSELI
EAVTGLRKTDSGTITLNGKQIQNLTPRKITESGIGHIPQDRHKHGLVLDFPIGENILLQS
YYKKPYSALGVLHKGEMYKKARSLITEYDVRTPDEYTHARALSGGNQQKAIIGREIDRNP
DLLIAAQPTRGLDVGAIEFVHKKLIEQRDAGKAVLLLSFELEEIMNLSDRIAVIFEGRII
ASVNPQETTEQELGLLMAGSTQKEAGKANG

BLAST