GenomeNet

>bsu:BSU31590 no KO assigned | (RefSeq) yufS; hypothetical protein (A)
MKTKVVMCSGLFCSVFAGAFMLNQYDGRSGVAACDEWELYLLEHHLSARMSETESKDLPF
GPREYIRIVNK

BLAST