GenomeNet

>bsu:BSU31630 K05568 multicomponent Na+:H+ antiporter subunit D | (RefSeq) mrpD; Na(+)/H(+) antiporter subunit D (A)
MNNFVILPILIPLLSAILLIFMTKNLMLMRIFSTAASAIGIVISGILVQTVFTKGIQTLS
LGGWKAPYGIVLAADQFASLLVLTTAIIGLLVGLYSFRSVGEKRERSFYYSGVQFLLAGV
SGAFLTGDLFNMYVFFELLLIASYMLIVLGGTKIQLRESLKYIVFNIVSSALFVIGVGFL
YAVTGTLNMADLSVKISESGQTGLITVIGVLLLLVFGMKGGIFPLYFWLPGSYYAPPAAI
SALFGALLTKVGLYAITRVFTLIFIHDTAFTHQLMIWLAALTVIFGVIGSLAYSNVMKIV
IYNIITAVGVILFGVAVHTPASIQGAIYYLIHDMLIKGALFMLAGTLIALTGTASLHKMG
GLIKRYPVLGWMFFISAISLAGIPPLSGFVGKFKIAEGGFAEGEFTISMLILLSSLLVLY
SVLRIFIHAFWGEEKETPKPNHRTAKGLLYPAAIFLLLSLLFGLGTEWVSPYVDQAAETL
LNPEKYIEAVLKE

BLAST