GenomeNet

>bsu:BSU31640 K05569 multicomponent Na+:H+ antiporter subunit E | (RefSeq) mrpE; Na(+)/H(+) antiporter subunit E (A)
MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKL
CFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMD
ISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR

BLAST