GenomeNet

>bsu:BSU31650 K05570 multicomponent Na+:H+ antiporter subunit F | (RefSeq) mrpF; Na(+)/H(+) antiporter subunit F (A)
MFTLILQIALGIMAVSTFLYVIRVIKGPTVPDRVVALDAIGINLIAITALVSILLKTSAF
LDIILLLGILSFIGTIAFSKFLEKGEIIENDRNR

BLAST