GenomeNet

>bsu:BSU31660 K05571 multicomponent Na+:H+ antiporter subunit G | (RefSeq) mrpG; Na(+)/H(+) antiporter subunit G (A)
MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLW
FVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKE
DSYL

BLAST