GenomeNet

>bsu:BSU31700 K02253 competence protein ComX | (RefSeq) comX; competence pheromone (A)
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

BLAST