GenomeNet

>bsu:BSU31970 K01252 bifunctional isochorismate lyase / aryl carrier protein [EC:3.3.2.1 6.3.2.14] | (RefSeq) dhbB; isochorismatase (A)
MAIPAIQPYQMPTASDMPQNKVSWVPDPNRAVLLIHDMQNYFVDAFTAGASPVTELSANI
RKLKNQCVQLGIPVVYTAQPGSQNPDDRALLTDFWGPGLNSGPYEEKIITELAPEDDDLV
LTKWRYSAFKRTNLLEMMRKEGRDQLIITGIYAHIGCLVTACEAFMEDIKAFFVGDAVAD
FSLEKHQMALEYAAGRCAFTVMTDSLLDQLQNAPADVQKTSANTGKKNVFTCENIRKQIA
ELLQETPEDITDQEDLLDRGLDSVRIMTLVEQWRREGAEVTFVELAERPTIEEWQKLLTT
RSQQVLPNADYL

BLAST