GenomeNet

>bsu:BSU32010 K07017 uncharacterized protein | (RefSeq) besA; ferri-bacillibactin esterase BesA (A)
MKEQTTDRTNGGTSNAFTIPGTEVRMMSSRNENRTYHIFISKPSTPPPPAGYPVIYLLDA
NSVFGTMTEAVRIQGRRPEKTGVIPAVIVGIGYETAEPFSSARHRDFTMPTAQSKLPERP
DGREWPEHGGAEGFFRFIEEDLKPEIERDYQIDKKRQTIFGHSLGGLFVLQVLLTKPDAF
QTYIAGSPSIHWNKPFILKKTDHFVSLTKKNNQPINILLAAGELEQHHKSRMNDNARELY
ERLAVLSEQGIRAEFCEFSGEGHISVLPVLVSRALRFALHPDGPHLSMG

BLAST