GenomeNet

>bsu:BSU32090 no KO assigned | (RefSeq) yuiA; hypothetical protein (A)
MKTATTTASHACPFCSGKGYFQLILGGSETCPSCQGTGKDSHSFSSR

BLAST