GenomeNet

>bsu:BSU32160 K13628 iron-sulfur cluster assembly protein | (RefSeq) yutM; hypothetical protein (A)
MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFDQ
HGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

BLAST