GenomeNet

>bsu:BSU32190 no KO assigned | (RefSeq) yuzB; hypothetical protein (A)
MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMGET
PAELVENIYTFIEENPMF

BLAST