GenomeNet

>bsu:BSU32470 K00087 xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4] | (RefSeq) pucE; xanthine dehydrogenase subunit E (A)
MDIKEAGPFPVKKEQFRMTVNGQAWEVAAVPTTHLSDLLRKEFQLTGTKVSCGIGRCGAC
SILIDGKLANACMTMAYQADGHSITTIEGLQKEELDMCQTAFLEEGGFQCGYCTPGMIIA
LKALFRETPQPSDKDIEEGLAGNLCRCTGYGGIMRSACRIRRELNGGRRESGF

BLAST