GenomeNet

>bsu:BSU32580 K10119 raffinose/stachyose/melibiose transport system permease protein | (RefSeq) frlM; ABC transporter permease (A)
MLPQKKTDSFRLEPVPDQHIEVKDKPRRKWYIGETSVWVFLFLYLIAIAYPLLWMVMSAF
KNSDDIFEHSWSLPSSWHPENFVSAWNQGISSYFMNSVIVTALTCVITVFISAWAAYGLS
RFEFKGKGFFLVLCLGGLMLTPQVSLVPLYSIIQSLGLYNTYWALILPYAAYRIPFTIIL
IRSYFLSISKELEEAAYLDGCTSFGVFFRIFLPMSVPILVTSGILTAYHTWNEFMFAIIF
IDDENLRTIPAGLMQFRDALQTDWGVLLAGLTISAAPIIILFLLMQKYFVRGIASGSVKG

BLAST